Tel:
China Raw Steroid Powders manufacturer
Zhuhai Jiacheng Bio-Tech Co., Ltd.

Zhuhai Jiacheng Bio-Tech Co., Ltd.

 

Supply pharmaceutical intermediates, steroid hormones, Trenbolone Enanthate, Testosterone Enanthate for bodybuilding use.

Home ProductsRaw Steroid Powders

Off - White Crystalline Raw Steroid Powders / Muscle Growth Hormone For Bodybuilding

Off - White Crystalline Raw Steroid Powders / Muscle Growth Hormone For Bodybuilding

    • Off - White Crystalline Raw Steroid Powders / Muscle Growth Hormone For Bodybuilding
    • Off - White Crystalline Raw Steroid Powders / Muscle Growth Hormone For Bodybuilding
  • Off - White Crystalline Raw Steroid Powders / Muscle Growth Hormone For Bodybuilding

    Product Details:

    Place of Origin: Guangdong ,China
    Brand Name: KA-XING
    Certification: HPLC and COA
    Model Number: 315-37-7
    Type: bodybuilding steroid

    Payment & Shipping Terms:

    Minimum Order Quantity: 50g
    Price: Negotiated
    Packaging Details: 5g,50g,100g,500g,1kg/foil bag or as requirements
    Delivery Time: 3 days by DHL
    Payment Terms: T/T,Moneygram, Bitcoins
    Supply Ability: 1T/month
    Contact Now
    Detailed Product Description
    Color: Off-white Crystalline Powder CAS: 315-37-7
    Grade: Pharmaceutical Grade Carnitine USe: Muscle Growth
    Users: Bodybuilders

     
    CJC-1295 without DAC from Peptides
    1.Quick Detail:
     
    Product Name: CJC-1295
    English name: CJC-1295 (without DAC)
    CAS number: 863288-34-0
    Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Tyr- Gln-Asp-Ile-Leu-Ser-Arg-NH2
    Molecular formula: C152H252N44O42
    Molecular weight: 3367.97
    Purity: 98%
    Traits: white powder
     
    CJC-1295 without DAC, a 29-amino acid peptide with sequence Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2, is a tetrasubstituted peptide analogue of GHRH with D-Ala, Gln, Ala, and Leu substitutions at positions 2, 8, 15, and 27 respectively which can make the peptide more stable. One of its advantages over traditional GHRH is its ability to bioconjugate with serum albumin, thus increasing its half-life and therapeutic window. It accomplishes this by using protecting groups around the amino acids of GHRH typically susceptible to enzymatic degradation. In clinical research, the objective of the peptide was to treat visceral fat deposits in obese AIDS patients, as increased levels of exogenous HGH are presumed to increase lipolysis (fat loss).
     2 How CJC-1295 Works
    CJC-1295 acts for much longer than pure GRF. It acts on the pituitary gland and keeps stimulating the release of growth hormone in pulses. The peptide then finds a neucleophilic unit within the blood and reacts with it in order to create a firmer bond. The reason why it acts in pulses is because the axis of the human growth hormone controls how much of the hormone can remain in the body at a time. This maintains the homeostatic environment in the body.


     3.The Effect;
     

    For fat-loss, body-building, repair of injury: Multiple doses, together with exercise and a proper diet. This will reduce fat levels and add to muscle mass.

     
    Off - White Crystalline Raw Steroid Powders / Muscle Growth Hormone For Bodybuilding
     
    4. Packaging & Delivery:
     
    Prudent packaging
     
     
    5.Commerce clause:
     
    Minimum Order Quantity: 100g
    Delivery Time: 3 days
    Payment Terms:TT, Moneygram and Western Union, Bitcoin, cash.
    shipping partner: DHL, UPS, TNT, FEDEX, HKEMS
     
     
    6.Our advantages:
    1.Our company is a professional production leading factory in China in pharmaceutical area of 20years,our products have exported to Germany, Spain, UK, USA, Australia, Middle East, and so on other country, and we have got very good feedback from our customers, we had Established long friendly relations of cooperation
    2. High quality, best price, first-class service, high successful delivery rate
    3. We have stock at China, Europe, Canada, so we can delivery quickly at the very day when receive the payment
    Contace setails:
    Email: jxkchen@gmail.com
    Skype: linwenchen88
    WhatsApp:+8613326610110
    http://www.raw-steroid-powders.com
     
     
     

    Polypeptide
    NO. Name specification
    T-A001 MGF 2mg
    T-A002 PEG MGF 2mg
    T-A003 CJC-1295 with DAC 2mg
    T-A004 CJC-1295 without DAC 2mg
    T-A005 PT-141 10mg
    T-A006 MT-1 10mg
    T-A007 MT-2 10mg
    T-A008 GHRP-2 5mg
    T-A008 GHRP-2 10mg
    T-A009 GHRP-6 5mg
    T-A009 GHRP-6 10mg
    T-A010 Ipamorelin 2mg
    T-A011 Hexarelin 2mg
    T-A012 Sermorelin 2mg
    T-A013 Oxytocin 2mg
    T-A014 TB500 2mg
    T-A015 pentadecapeptide BPC 157 2mg
    T-A016 HGH 176-191 2mg
    T-A017 Triptorelin 2mg
    T-A018 Tesamorelin 2mg
    T-A020 Gonadorelin 2mg
    T-A020 Gonadorelin 10mg
    T-A021 DSIP 2mg
    T-A022 Selank 5mg
         
         
      HGH 200iu kit
      HGH 100iu kit
      HCG 5000iu vial
         

     
     

    SARMS
    Name CAS NO.
    Ostarine,MK-2866, Enobosarm 841205-47-8
    Andarine (S-4) 401900-40-1
    MK-677, Ibutamoren,mesylate 159752-10-0
    LGD-4033 1165910-22-4
    GW-501516/Cardarine 317318-70-0
    AICAR 2627-69-2
    SR9009 137986-29-9
    RAD-140 118237-47-0
    Flibanserin 167933-07-5
    Carphedon 77472-70-9
    Coluracetam 135463-81-9
    Sunifiram 314728-85-3
    Adrafinil 63547-13-7
    Pirfenidone 53179-13-8
    YK11 1370003-76-1
       
    ACE-031  

    Contact Details
    Zhuhai Jiacheng Bio-Tech Co., Ltd.

    Contact Person: yuansen

    Send your inquiry directly to us (0 / 3000)

    Zhuhai Jiacheng Bio-Tech Co., Ltd.
    Room C, 23rd Floor, Block 3 La Cite, Areia Preta, Macao
    Tel:86--13326610110
    China Good Quality Raw Steroid Powders Supplier. Copyright © 2014 - 2018 raw-steroid-powders.com. All Rights Reserved.